PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_005621-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 269aa    MW: 31044.5 Da    PI: 6.1261
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_005621-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.7e-182774148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll+++v+ +G g+W++ a+  g++Rt+k+c++rw++yl
  AHYPO_005621-RA 27 RGPWTLEEDTLLIHYVACHGEGRWNLLAKSAGLKRTGKSCRLRWLNYL 74
                     89********************************************97 PP

2Myb_DNA-binding50.83.7e-1680123146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ +++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  AHYPO_005621-RA  80 RGNLSPQEQLLILELHSKWGNR-WSKIAAHLP-GRTDNEIKNYWRT 123
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.8742274IPR017930Myb domain
SuperFamilySSF466893.41E-3124121IPR009057Homeodomain-like
SMARTSM007172.0E-142676IPR001005SANT/Myb domain
PfamPF002497.6E-172774IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-232881IPR009057Homeodomain-like
CDDcd001671.94E-102974No hitNo description
PROSITE profilePS5129425.16475129IPR017930Myb domain
SMARTSM007176.5E-1579127IPR001005SANT/Myb domain
PfamPF002493.0E-1580123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2382128IPR009057Homeodomain-like
CDDcd001672.15E-1084123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MKTEKSCNNT NNEIQKDHQE EEQELRRGPW TLEEDTLLIH YVACHGEGRW NLLAKSAGLK  60
RTGKSCRLRW LNYLKPDIKR GNLSPQEQLL ILELHSKWGN RWSKIAAHLP GRTDNEIKNY  120
WRTRVQKQAR QLNMESNSQS FIDAIRCFYM PRLVEKIEQN SSDHEIISVN PNDQSQIILS  180
NNSILDDSNA SLSYQHQQHP TSSKSSSSLV LDDHEPSHSC TYDVDMSASM SSSDVPFDGC  240
HVERNDWIGN DMAGDSMWDL DELWQFRK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-25241294108B-MYB
1gv2_A6e-25241291105MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-242412955159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-242412955159MYB PROTO-ONCOGENE PROTEIN
1h8a_C8e-252412924128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00159DAPTransfer from AT1G25340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010681493.11e-120PREDICTED: transcription factor MYB108 isoform X1
SwissprotQ9LDE17e-64MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0K9QG061e-138A0A0K9QG06_SPIOL; Uncharacterized protein
STRINGPOPTR_0008s12130.19e-93(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.13e-84myb domain protein 62